Products

cDNA Clones (48)
Proteins (30)
RNAi (12)
Gene Expression (6)
Antibodies (2)
Jump to Filters
View as table Download
DHRS9 (NM_199204) Human Tagged ORF Clone
RC220853

USD 420.00

In Stock

DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DHRS9 (NM_199204) Human Tagged ORF Clone Lentiviral Particle
RC220853L1V

USD 820.00

3 Weeks

Lenti ORF particles, DHRS9 (Myc-DDK tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone Lentiviral Particle
RC220853L2V

USD 820.00

6 Weeks

Lenti ORF particles, DHRS9 (mGFP-tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone
RG220853

USD 460.00

In Stock

DHRS9 (GFP-tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dhrs9 (NM_175512) Mouse Tagged ORF Clone
MR219971

USD 68.00

USD 149.00

In Stock

Dhrs9 (Myc-DDK-tagged) - Mouse dehydrogenase/reductase (SDR family) member 9 (Dhrs9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DHRS9 (NM_005771) Human Tagged ORF Clone
RC208901

USD 420.00

In Stock

DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DHRS9 (NM_001142270) Human Tagged ORF Clone
RC226895

USD 420.00

In Stock

DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DHRS9 (NM_001142271) Human Tagged ORF Clone
RC226904

USD 420.00

In Stock

DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DHRS9 Human Gene Knockout Kit (CRISPR)
KN408901

USD 1,290.00

2 Weeks

DHRS9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN408901 is the updated version of KN208901.
Dhrs9 Mouse Gene Knockout Kit (CRISPR)
KN504555

USD 1,290.00

2 Weeks

Dhrs9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN504555 is the updated version of KN304555.
Dhrs9 (NM_175512) Mouse Tagged ORF Clone
MG219971

USD 300.00

3 Weeks

Dhrs9 (GFP-tagged) - Mouse dehydrogenase/reductase (SDR family) member 9 (Dhrs9), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dhrs9 (NM_175512) Mouse Tagged ORF Clone
MR219971L3

USD 500.00

3 Weeks

Lenti ORF clone of Dhrs9 (Myc-DDK-tagged) - Mouse dehydrogenase/reductase (SDR family) member 9 (Dhrs9)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dhrs9 (NM_175512) Mouse Tagged ORF Clone Lentiviral Particle
MR219971L3V

USD 700.00

6 Weeks

Lenti ORF particles, Dhrs9 (Myc-DDK-tagged) - Mouse dehydrogenase/reductase (SDR family) member 9 (Dhrs9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dhrs9 (NM_175512) Mouse Tagged ORF Clone
MR219971L4

USD 500.00

3 Weeks

Lenti ORF clone of Dhrs9 (mGFP-tagged) - Mouse dehydrogenase/reductase (SDR family) member 9 (Dhrs9)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dhrs9 (NM_175512) Mouse Tagged ORF Clone Lentiviral Particle
MR219971L4V

USD 700.00

6 Weeks

Lenti ORF particles, Dhrs9 (GFP-tagged) - Mouse dehydrogenase/reductase (SDR family) member 9 (Dhrs9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_005771) Human Tagged ORF Clone
RC208901L3

USD 620.00

3 Weeks

Lenti-ORF clone of DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_005771) Human Tagged ORF Clone Lentiviral Particle
RC208901L3V

USD 820.00

6 Weeks

Lenti ORF particles, DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_005771) Human Tagged ORF Clone
RC208901L4

USD 620.00

3 Weeks

Lenti-ORF clone of DHRS9 (mGFP-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_005771) Human Tagged ORF Clone Lentiviral Particle
RC208901L4V

USD 820.00

6 Weeks

Lenti ORF particles, DHRS9 (mGFP-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone
RC220853L3

USD 620.00

3 Weeks

Lenti ORF clone of Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone Lentiviral Particle
RC220853L3V

USD 820.00

5 Weeks

Lenti ORF particles, DHRS9 (Myc-DDK tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone
RC220853L4

USD 620.00

3 Weeks

Lenti ORF clone of Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone Lentiviral Particle
RC220853L4V

USD 820.00

7 Weeks

Lenti ORF particles, DHRS9 (mGFP-tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142270) Human Tagged ORF Clone
RC226895L3

USD 620.00

3 Weeks

Lenti-ORF clone of DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142270) Human Tagged ORF Clone Lentiviral Particle
RC226895L3V

USD 820.00

6 Weeks

Lenti ORF particles, DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142270) Human Tagged ORF Clone
RC226895L4

USD 620.00

3 Weeks

Lenti-ORF clone of DHRS9 (mGFP-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142270) Human Tagged ORF Clone Lentiviral Particle
RC226895L4V

USD 820.00

6 Weeks

Lenti ORF particles, DHRS9 (mGFP-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142271) Human Tagged ORF Clone
RC226904L3

USD 620.00

3 Weeks

Lenti-ORF clone of DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142271) Human Tagged ORF Clone Lentiviral Particle
RC226904L3V

USD 820.00

6 Weeks

Lenti ORF particles, DHRS9 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142271) Human Tagged ORF Clone
RC226904L4

USD 620.00

3 Weeks

Lenti-ORF clone of DHRS9 (mGFP-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001142271) Human Tagged ORF Clone Lentiviral Particle
RC226904L4V

USD 820.00

6 Weeks

Lenti ORF particles, DHRS9 (mGFP-tagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_001289763) Human Tagged ORF Clone
RC237851

USD 420.00

2 Weeks

DHRS9 (myc-DDK-tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DHRS9 (NM_005771) Human Tagged ORF Clone
RG208901

USD 460.00

3 Weeks

DHRS9 (GFP-tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DHRS9 (NM_001142270) Human Tagged ORF Clone
RG226895

USD 460.00

3 Weeks

DHRS9 (GFP-tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DHRS9 (NM_001142271) Human Tagged ORF Clone
RG226904

USD 460.00

3 Weeks

DHRS9 (GFP-tagged) - Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Dhrs9 (NM_130819) Rat Tagged ORF Clone
RR201252

USD 420.00

4 Weeks

Dhrs9 (Myc-DDK-tagged ORF) - Rat dehydrogenase/reductase (SDR family) member 9 (Dhrs9), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Dhrs9 (NM_130819) Rat Tagged ORF Clone
RR201252L3

USD 640.00

8 Weeks

Lenti ORF clone of Dhrs9 (Myc-DDK-tagged ORF) - Rat dehydrogenase/reductase (SDR family) member 9 (Dhrs9), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dhrs9 (NM_130819) Rat Tagged ORF Clone Lentiviral Particle
RR201252L3V

USD 850.00

12 Weeks

Lenti ORF particles, Dhrs9 (Myc-DDK-tagged ORF) - Rat dehydrogenase/reductase (SDR family) member 9 (Dhrs9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Dhrs9 (NM_130819) Rat Tagged ORF Clone
RR201252L4

USD 700.00

8 Weeks

Lenti ORF clone of Dhrs9 (mGFP-tagged ORF) - Rat dehydrogenase/reductase (SDR family) member 9 (Dhrs9), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Dhrs9 (NM_130819) Rat Tagged ORF Clone Lentiviral Particle
RR201252L4V

USD 960.00

12 Weeks

Lenti ORF particles, Dhrs9 (GFP-tagged ORF) - Rat dehydrogenase/reductase (SDR family) member 9 (Dhrs9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone
RC220853L1

USD 620.00

In Stock

Lenti ORF clone of Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DHRS9 (NM_199204) Human Tagged ORF Clone
RC220853L2

USD 620.00

3 Weeks

Lenti ORF clone of Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DHRS9 (NM_005771) Human Over-expression Lysate
LC429267

USD 121.00

In Stock

DHRS9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DHRS9 (NM_199204) Human Over-expression Lysate
LY404693

USD 396.00

5 Days

Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DHRS9 (NM_005771) Human Over-expression Lysate
LY429267

USD 396.00

In Stock

Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DHRS9 (NM_199204) Human Untagged Clone
SC126331

USD 310.00

In Stock

DHRS9 (untagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DHRS9 (NM_005771) Human Untagged Clone
SC324032

USD 660.00

In Stock

DHRS9 (untagged)-Human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
DHRS9 Rabbit Polyclonal Antibody
TA337615

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHRS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHRS9 antibody: synthetic peptide directed towards the middle region of human DHRS9. Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
DHRS9 Human shRNA Lentiviral Particle (Locus ID 10170)
TL305004V

USD 1,395.00

5 Weeks

DHRS9 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
DHRS9 (18-319, His-tag) Human Protein
AR50168PU-N

USD 1,105.00

2 Weeks

DHRS9 (18-319, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli