Germany
Japan
United Kingdom
China
GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GPR85 (Myc-DDK tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GPR85 (mGFP-tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Gpr85 (GFP-tagged) - Mouse G protein-coupled receptor 85 (Gpr85)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gpr85 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 85 (Gpr85)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR85 (GFP-tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gpr85 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor 85 (Gpr85), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human G protein-coupled receptor 85 (GPR85)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GPR85 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405181 is the updated version of KN205181.
Gpr85 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507264 is the updated version of KN307264.
Lenti ORF clone of Gpr85 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 85 (Gpr85)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr85 (Myc-DDK-tagged) - Mouse G protein-coupled receptor 85 (Gpr85), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gpr85 (mGFP-tagged) - Mouse G protein-coupled receptor 85 (Gpr85)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr85 (GFP-tagged) - Mouse G protein-coupled receptor 85 (Gpr85), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 85 (GPR85), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (Myc-DDK tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor 85 (GPR85), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (mGFP-tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR85 (mGFP-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (mGFP-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR85 (mGFP-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (mGFP-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (Myc-DDK-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GPR85 (mGFP-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPR85 (mGFP-tagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPR85 (GFP-tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR85 (GFP-tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GPR85 (GFP-tagged) - Human G protein-coupled receptor 85 (GPR85), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gpr85 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor 85 (Gpr85), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr85 (Myc-DDK-tagged ORF) - Rat G protein-coupled receptor 85 (Gpr85), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gpr85 (mGFP-tagged ORF) - Rat G protein-coupled receptor 85 (Gpr85), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gpr85 (GFP-tagged ORF) - Rat G protein-coupled receptor 85 (Gpr85), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPR85 (untagged)-Human G protein-coupled receptor 85 (GPR85), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human G protein-coupled receptor 85 (GPR85), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human G protein-coupled receptor 85 (GPR85), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of G protein-coupled receptor 85 (GPR85), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Gpr85
Rabbit Polyclonal Anti-GPR85 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR85 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR85. Synthetic peptide located within the following region: YFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCF |
Rabbit Polyclonal Anti-GPR85 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SREB / GPR85 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human GPR85. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Lizard, Xenopus (100%); Stickleback, Pufferfish, Zebrafish (94%). |
Rabbit Polyclonal Anti-GPR85 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SREB / GPR85 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human GPR85. Percent identity with other species by BLAST analysis: Human, Orangutan, Mouse, Rat, Turkey, Chicken, Lizard, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
GPR85 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor 85
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gpr85 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor 85
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Active filters
Target Symbol
- GPR85