Germany
Japan
United Kingdom
China
Htr1f (GFP-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadHtr1f (Myc-DDK-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR1F (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 1F (HTR1F)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR1F (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 1F (HTR1F)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Htr1f - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508027 is the updated version of KN308027.
Lenti ORF clone of Htr1f (Myc-DDK-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr1f (Myc-DDK-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Htr1f (mGFP-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr1f (GFP-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HTR1F (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 1F (HTR1F)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HTR1F (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 1F (HTR1F), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HTR1F (mGFP-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 1F (HTR1F)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, HTR1F (mGFP-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 1F (HTR1F), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Htr1f (Myc-DDK-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Htr1f (Myc-DDK-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr1f (Myc-DDK-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Htr1f (mGFP-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr1f (GFP-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HTR1F (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 1F (HTR1F)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-5-HT-1F antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-1F. |
Rabbit Polyclonal Anti-HTR1F Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Bovine, Rabbit (100%); Mouse, Elephant, Panda, Bat, Guinea pig (95%); Platypus (84%). |
5 HT1F (HTR1F) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
qSTAR qPCR primer pairs against Homo sapiens gene HTR1F
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal Anti-HTR1F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR1F antibody: synthetic peptide directed towards the N terminal of human HTR1F. Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV |
Rabbit Polyclonal Anti-HTR1F Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1F / 5-HT1F Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Guinea pig, Turkey, Chicken, Platypus (100%); Xenopus, Stickleback, Pufferfish (94%); Opossum, Lizard (88%); Horse (82%). |
Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey, Panda, Bat (100%); Gibbon, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Rabbit (95%); Horse (89%). |
Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1F / 5-HT1F Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Horse, Rabbit, Guinea pig, Platypus (94%); Dog, Bat (88%); Rat, Panda (81%). |
HTR1F CRISPRa kit - CRISPR gene activation of human 5-hydroxytryptamine receptor 1F
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Htr1f CRISPRa kit - CRISPR gene activation of mouse 5-hydroxytryptamine (serotonin) receptor 1F
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene HTR1F
| Application | Plasmid of exact quantity for transcript copy number calculation |
Htr1f (untagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Htr1f
Htr1f (untagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 1F (Htr1f), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
HTR1F (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR320575 is the updated version of SR302278.
Htr1f (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Htr1f (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
HTR1F Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1). |
| Modifications | Unmodified |
Transient overexpression of HTR1F (NM_000866) in HEK293T cells paraffin embedded controls for ICC/IHC staining
HTR1F - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
HTR1F - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Htr1f - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Htr1f - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Htr1f - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Htr1f - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
HTR1F - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Htr1f - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Htr1f - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of HTR1F (NM_000866) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HTR1F (NM_000866) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HTR1F