Germany
Japan
United Kingdom
China
PSME2 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Psme2 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, PSME2 (Myc-DDK tagged) - Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PSME2 (mGFP-tagged) - Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PSME2 (GFP-tagged) - Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSME2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402431 is the updated version of KN202431.
Psme2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514130 is the updated version of KN314130.
Psme2 (GFP-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Psme2 (GFP-tagged) - Mouse proteasome (prosome macropain) 28 subunit beta (Psme2) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Psme2 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psme2 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Psme2 (mGFP-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psme2 (GFP-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Psme2 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Psme2 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psme2 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Psme2 (mGFP-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psme2 (GFP-tagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PSME2 (Myc-DDK tagged) - Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PSME2 (mGFP-tagged) - Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Psme2 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) activator subunit 2 (Psme2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Psme2 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) activator subunit 2 (Psme2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psme2 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) activator subunit 2 (Psme2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Psme2 (mGFP-tagged ORF) - Rat proteasome (prosome, macropain) activator subunit 2 (Psme2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psme2 (GFP-tagged ORF) - Rat proteasome (prosome, macropain) activator subunit 2 (Psme2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-PSME2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME2 |
Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PSME2 (untagged)-Human proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Polyclonal Antibody against PSME2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLEKIVNPKGEEKP, from the C Terminus of the protein sequence according to NP_002809.2. |
PSME2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (PSME2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PSME2 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human PSME2 |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV |
PSME2 / REG-beta (1-239, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
PSME2 / REG-beta (1-239, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
PSME2 CRISPRa kit - CRISPR gene activation of human proteasome activator subunit 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Psme2 CRISPRa kit - CRISPR gene activation of mouse proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PSME2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PSME2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Psme2 (untagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Psme2 (untagged) - Mouse proteasome (prosome, macropain) 28 subunit, beta (Psme2), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Psme2
PSME2 MS Standard C13 and N15-labeled recombinant protein (NP_002809)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Psme2 (untagged ORF) - Rat proteasome (prosome, macropain) activator subunit 2 (Psme2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- PSME2