Germany
Japan
United Kingdom
China
RORB (Myc-DDK-tagged)-Human RAR-related orphan receptor B (RORB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human RAR-related orphan receptor B (RORB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, RORB (Myc-DDK tagged) - Human RAR-related orphan receptor B (RORB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, RORB (mGFP-tagged) - Human RAR-related orphan receptor B (RORB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (cDNA clone MGC:38728 IMAGE:5358124)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rorb (GFP-tagged) - Mouse RAR-related orphan receptor beta (Rorb) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RORB (GFP-tagged) - Human RAR-related orphan receptor B (RORB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rorb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514987 is the updated version of KN314987.
Rorb (GFP-tagged) - Mouse RAR-related orphan receptor beta (cDNA clone MGC:38728 IMAGE:5358124)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rorb (GFP-tagged) - Mouse RAR-related orphan receptor beta (Rorb) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (cDNA clone MGC:38728 IMAGE:5358124)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (cDNA clone MGC:38728 IMAGE:5358124), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rorb (mGFP-tagged) - Mouse RAR-related orphan receptor beta (cDNA clone MGC:38728 IMAGE:5358124)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rorb (GFP-tagged) - Mouse RAR-related orphan receptor beta (cDNA clone MGC:38728 IMAGE:5358124), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rorb (mGFP-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rorb (GFP-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rorb (Myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rorb (mGFP-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rorb (GFP-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rorb (myc-DDK-tagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, RORB (Myc-DDK tagged) - Human RAR-related orphan receptor B (RORB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, RORB (mGFP-tagged) - Human RAR-related orphan receptor B (RORB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rorb (myc-DDK-tagged) - Rat RAR-related orphan receptor B (Rorb)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RORB (untagged)-Human RAR-related orphan receptor B (RORB)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RORB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK |
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat, Sheep |
| Immunogen | RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%). |
Rorb (untagged) - Mouse RAR-related orphan receptor beta (Rorb), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RORB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human RAR-related orphan receptor B (RORB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RORB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of RAR-related orphan receptor B (RORB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rorb - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rorb - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RORB mouse monoclonal antibody, clone OTI3D7 (formerly 3D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) RORB mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RORB CRISPRa kit - CRISPR gene activation of human RAR related orphan receptor B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Rorb CRISPRa kit - CRISPR gene activation of mouse RAR-related orphan receptor beta
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RORB
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- RORB