Products

cDNA Clones (43)
RNAi (12)
Proteins (8)
Gene Expression (7)
Antibodies (5)
Jump to Filters
View as table Download
RPL30 (NM_000989) Human Tagged ORF Clone
RC216355

USD 98.00

USD 390.00

In Stock

RPL30 (Myc-DDK-tagged)-Human ribosomal protein L30 (RPL30)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Rpl30 (NM_009083) Mouse Tagged ORF Clone
MR200484

USD 68.00

USD 390.00

In Stock

Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl30 (BC002060) Mouse Tagged ORF Clone
MR200480

USD 68.00

USD 310.00

In Stock

Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (cDNA clone MGC:6114 IMAGE:3489311)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl30 (NM_001163485) Mouse Tagged ORF Clone
MR216296

USD 330.00

In Stock

Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL30 (NM_000989) Human Tagged ORF Clone
RG216355

USD 460.00

In Stock

RPL30 (GFP-tagged) - Human ribosomal protein L30 (RPL30)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RPL30 Human Gene Knockout Kit (CRISPR)
KN416355

USD 1,290.00

2 Weeks

RPL30 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN416355 is the updated version of KN216355.
Rpl30 Mouse Gene Knockout Kit (CRISPR)
KN515036

USD 1,290.00

2 Weeks

Rpl30 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515036 is the updated version of KN315036.
Rpl30 (BC002060) Mouse Tagged ORF Clone
MG200480

USD 300.00

3 Weeks

Rpl30 (GFP-tagged) - Mouse ribosomal protein L30 (cDNA clone MGC:6114 IMAGE:3489311)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl30 (BC092137) Mouse Tagged ORF Clone
MG200484

USD 300.00

3 Weeks

Rpl30 (GFP-tagged) - Mouse ribosomal protein L30 (cDNA clone MGC:106425 IMAGE:6823165)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl30 (NM_001163485) Mouse Tagged ORF Clone
MG216296

USD 300.00

3 Weeks

Rpl30 (GFP-tagged) - Mouse ribosomal protein L30 (Rpl30) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl30 (BC002060) Mouse Tagged ORF Clone
MR200480L3

USD 500.00

3 Weeks

Lenti ORF clone of Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (cDNA clone MGC:6114 IMAGE:3489311)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (BC002060) Mouse Tagged ORF Clone Lentiviral Particle
MR200480L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (cDNA clone MGC:6114 IMAGE:3489311), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (BC002060) Mouse Tagged ORF Clone
MR200480L4

USD 500.00

3 Weeks

Lenti ORF clone of Rpl30 (mGFP-tagged) - Mouse ribosomal protein L30 (cDNA clone MGC:6114 IMAGE:3489311)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (BC002060) Mouse Tagged ORF Clone Lentiviral Particle
MR200480L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl30 (GFP-tagged) - Mouse ribosomal protein L30 (cDNA clone MGC:6114 IMAGE:3489311), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_009083) Mouse Tagged ORF Clone
MR200484L3

USD 500.00

3 Weeks

Lenti ORF clone of Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_009083) Mouse Tagged ORF Clone Lentiviral Particle
MR200484L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_009083) Mouse Tagged ORF Clone
MR200484L4

USD 500.00

3 Weeks

Lenti ORF clone of Rpl30 (mGFP-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_009083) Mouse Tagged ORF Clone Lentiviral Particle
MR200484L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl30 (GFP-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_001163485) Mouse Tagged ORF Clone
MR216296L3

USD 500.00

3 Weeks

Lenti ORF clone of Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_001163485) Mouse Tagged ORF Clone Lentiviral Particle
MR216296L3V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl30 (Myc-DDK-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_001163485) Mouse Tagged ORF Clone
MR216296L4

USD 500.00

3 Weeks

Lenti ORF clone of Rpl30 (mGFP-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_001163485) Mouse Tagged ORF Clone Lentiviral Particle
MR216296L4V

USD 700.00

6 Weeks

Lenti ORF particles, Rpl30 (GFP-tagged) - Mouse ribosomal protein L30 (Rpl30), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL30 (NM_000989) Human Tagged ORF Clone
RC216355L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L30 (RPL30), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL30 (NM_000989) Human Tagged ORF Clone
RC216355L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L30 (RPL30), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_022699) Rat Tagged ORF Clone
RR213836

USD 420.00

3 Weeks

Rpl30 (Myc-DDK-tagged ORF) - Rat ribosomal protein L30 (Rpl30), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rpl30 (NM_022699) Rat Tagged ORF Clone
RR213836L3

USD 640.00

7 Weeks

Lenti ORF clone of Rpl30 (Myc-DDK-tagged ORF) - Rat ribosomal protein L30 (Rpl30), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_022699) Rat Tagged ORF Clone Lentiviral Particle
RR213836L3V

USD 850.00

11 Weeks

Lenti ORF particles, Rpl30 (Myc-DDK-tagged ORF) - Rat ribosomal protein L30 (Rpl30), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_022699) Rat Tagged ORF Clone
RR213836L4

USD 700.00

7 Weeks

Lenti ORF clone of Rpl30 (mGFP-tagged ORF) - Rat ribosomal protein L30 (Rpl30), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Rpl30 (NM_022699) Rat Tagged ORF Clone Lentiviral Particle
RR213836L4V

USD 960.00

11 Weeks

Lenti ORF particles, Rpl30 (GFP-tagged ORF) - Rat ribosomal protein L30 (Rpl30), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RPL30 (NM_000989) Human Tagged ORF Clone
RC216355L1

USD 768.00

In Stock

Lenti ORF clone of Human ribosomal protein L30 (RPL30), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RPL30 (NM_000989) Human Untagged Clone
SC119495

USD 310.00

In Stock

RPL30 (untagged)-Human ribosomal protein L30 (RPL30)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RPL30 Rabbit Polyclonal Antibody
TA314464

USD 345.00

In Stock

Rabbit polyclonal anti-RPL30 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL30.
RPL30 (NM_000989) Human Tagged ORF Clone
RC216355L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ribosomal protein L30 (RPL30), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RPL30 (NM_000989) Human Recombinant Protein
TP760448

USD 215.00

In Stock

Purified recombinant protein of Human ribosomal protein L30 (RPL30), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
RPL30 Human shRNA Plasmid Kit (Locus ID 6156)
TR316701

USD 715.00

In Stock

RPL30 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
RPL30 (NM_000989) Human Over-expression Lysate
LC400356

USD 121.00

In Stock

RPL30 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
RPL30 Rabbit Polyclonal Antibody
TA336208

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPL30 Antibody: synthetic peptide directed towards the middle region of human RPL30. Synthetic peptide located within the following region: MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE
RPL30 Human qPCR Template Standard (NM_000989)
HK206394

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene RPL30

Application Plasmid of exact quantity for transcript copy number calculation
RPL30 Rabbit Polyclonal Antibody
TA336207

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPL30 Antibody: synthetic peptide directed towards the middle region of human RPL30. Synthetic peptide located within the following region: LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA
RPL30 (1-115, His-tag) Human Protein
AR51097PU-N

USD 845.00

2 Weeks

RPL30 (1-115, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
RPL30 (1-115, His-tag) Human Protein
AR51097PU-S

USD 330.00

2 Weeks

RPL30 (1-115, His-tag) human protein, 20 µg

Tag His-tag
Expression Host E. coli
Human RPL30 activation kit by CRISPRa
GA104168

USD 1,290.00

2 Weeks

RPL30 CRISPRa kit - CRISPR gene activation of human ribosomal protein L30

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Rpl30 activation kit by CRISPRa
GA203691

USD 1,290.00

2 Weeks

Rpl30 CRISPRa kit - CRISPR gene activation of mouse ribosomal protein L30

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
RPL30 Human qPCR Primer Pair (NM_000989)
HP200925

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene RPL30

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
RPL30 (NM_000989) Human Over-expression Lysate
LY400356

USD 396.00

5 Days

Transient overexpression lysate of ribosomal protein L30 (RPL30)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Rpl30 (BC002060) Mouse Untagged Clone
MC206856

USD 340.00

2 Weeks

Rpl30 (untagged) - Mouse ribosomal protein L30 (cDNA clone MGC:6114 IMAGE:3489311), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin