SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SCFD1 (Myc-DDK tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SCFD1 (mGFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Scfd1 (Myc-DDK-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCFD1 (GFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Scfd1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Scfd1 (GFP-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Scfd1 (GFP-tagged) - Mouse Sec1 family domain containing 1 (Scfd1), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Scfd1 (Myc-DDK-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Scfd1 (Myc-DDK-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Scfd1 (mGFP-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Scfd1 (GFP-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Scfd1 (Myc-DDK-tagged) - Mouse Sec1 family domain containing 1 (Scfd1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Scfd1 (Myc-DDK-tagged) - Mouse Sec1 family domain containing 1 (Scfd1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Scfd1 (Myc-DDK-tagged) - Mouse Sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Scfd1 (mGFP-tagged) - Mouse Sec1 family domain containing 1 (Scfd1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Scfd1 (GFP-tagged) - Mouse Sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SCFD1 (mGFP-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCFD1 (mGFP-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCFD1 (Myc-DDK tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SCFD1 (mGFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SCFD1 (Myc-DDK tagged) - Homo sapiens sec1 family domain containing 1 (SCFD1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCFD1 (myc-DDK-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCFD1 (myc-DDK-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCFD1 (myc-DDK-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SCFD1 (GFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SCFD1 (GFP-tagged) - Homo sapiens sec1 family domain containing 1 (SCFD1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Scfd1 (Myc-DDK-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Scfd1 (Myc-DDK-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Scfd1 (Myc-DDK-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Scfd1 (mGFP-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Scfd1 (GFP-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
SCFD1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of sec1 family domain containing 1 (SCFD1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-SCFD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SCFD1. |
SCFD1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SCFD1 (untagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SCFD1 (untagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SCFD1 (untagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
SCFD1 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human SCFD1 |
Rabbit polyclonal Anti-SCFD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCFD1 antibody: synthetic peptide directed towards the N terminal of human SCFD1. Synthetic peptide located within the following region: SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME |
Rabbit polyclonal Anti-SCFD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SCFD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SCFD1. Synthetic peptide located within the following region: YFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGK |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |