Products

View as table Download

USD 98.00

USD 790.00

In Stock

SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, SCFD1 (Myc-DDK tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SCFD1 (mGFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Scfd1 (Myc-DDK-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SCFD1 (GFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Scfd1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515353 is the updated version of KN315353.

Scfd1 (GFP-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Scfd1 (GFP-tagged) - Mouse Sec1 family domain containing 1 (Scfd1), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Scfd1 (Myc-DDK-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Scfd1 (Myc-DDK-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Scfd1 (mGFP-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Scfd1 (GFP-tagged) - Mouse sec1 family domain containing 1 (cDNA clone MGC:38021 IMAGE:5151118), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Scfd1 (Myc-DDK-tagged) - Mouse Sec1 family domain containing 1 (Scfd1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Scfd1 (Myc-DDK-tagged) - Mouse Sec1 family domain containing 1 (Scfd1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Scfd1 (Myc-DDK-tagged) - Mouse Sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Scfd1 (mGFP-tagged) - Mouse Sec1 family domain containing 1 (Scfd1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Scfd1 (GFP-tagged) - Mouse Sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCFD1 (Myc-DDK-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of SCFD1 (mGFP-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCFD1 (mGFP-tagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCFD1 (Myc-DDK tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SCFD1 (mGFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

SCFD1 (Myc-DDK tagged) - Homo sapiens sec1 family domain containing 1 (SCFD1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SCFD1 (myc-DDK-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SCFD1 (myc-DDK-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SCFD1 (myc-DDK-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SCFD1 (GFP-tagged) - Human sec1 family domain containing 1 (SCFD1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SCFD1 (GFP-tagged) - Homo sapiens sec1 family domain containing 1 (SCFD1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Scfd1 (Myc-DDK-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Scfd1 (Myc-DDK-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Scfd1 (Myc-DDK-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Scfd1 (mGFP-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Scfd1 (GFP-tagged ORF) - Rat sec1 family domain containing 1 (Scfd1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

SCFD1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Transient overexpression lysate of sec1 family domain containing 1 (SCFD1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human sec1 family domain containing 1 (SCFD1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal anti-SCFD1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SCFD1.

SCFD1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SCFD1 (untagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

SCFD1 (untagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

SCFD1 (untagged)-Human sec1 family domain containing 1 (SCFD1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

SCFD1 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human SCFD1

Rabbit polyclonal Anti-SCFD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCFD1 antibody: synthetic peptide directed towards the N terminal of human SCFD1. Synthetic peptide located within the following region: SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Rabbit polyclonal Anti-SCFD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SCFD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SCFD1. Synthetic peptide located within the following region: YFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGK

Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated