CASK Mouse Monoclonal Antibody [Clone ID: K56A/50]

CAT#: 73-000

CASK mouse monoclonal antibody, clone K56A/50

Product Images

Adult rat brain immunohistochemistry

• 

  Immunoblot against crude membrane fractions from whole mouse (MBM) or rat (RBM) brain and from human cerebellum [HBM(Cb)], cerebral cortex [HBM(Cx)] or hippocampus [HBM(H)] and probed with K56A/50 (left) or N52A/42 (right) TC supe.

• 

  adult rat brain membrane immunoblot

Specifications

Product Data

• Clone Name: K56A/50
• Applications: IHC, IP, WB
• Recommended Dilution: Immunoblot (IB)
  Immunohistochemistry (IHC)
  Immunoprecipitation (IP)
• Reactivities: Human, Mouse, Rat, Xenopus, Zebrafish
• Host: Mouse
• Isotype: IgG1
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 318-415 (first L27 domain, NSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEE) of human Peripheral plasma membrane protein CASK (also known as Calcium/calmodulin-dependent serine protein kinase, Protein lin-2 homolog and LIN2, accession number O14936)
  Rat: 100% identity (98/98 amino acids identical)
  Mouse: 100% identity (98/98 amino acids identical)
• Formulation: State: Supernatant
• Conjugation: Unconjugated
• Gene Name: calcium/calmodulin dependent serine protein kinase
• Database Link:
  Entrez Gene 8573 Human
  UniProt ID O14936
• Synonyms: Lin-2 homolog, LIN2
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
  "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
  Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
  View Research License Agreement