Kv1.2 (KCNA2) Mouse Monoclonal Antibody [Clone ID: K14/16]

CAT#: 73-008

Kv1.2 (KCNA2) mouse monoclonal antibody, clone K14/16

Product Images

adult rat brain membrane immunoblot.

• 

  immunoblot on brain membranes from wild-type (WT) and Kv1.2 knockout (Kv1.2-/-) mice and from adult rat brain (RBM).

• 

  adult rat hippocampus immunohistochemistry

• 

  immunoblot on membranes from whole rat (RBM) and mouse (MBM) brain and from human cerebral cortex [HBM(Cx)] and hippocampus [HBM(H)].

Specifications

Product Data

• Clone Name: K14/16
• Applications: IF, IHC, IP, WB
• Recommended Dilution: Immunoblot, Immunocytochemistry, Immunohistochemistry and Immunoprecipitation.
• Reactivities: Human, Mouse, Rat, Xenopus, Zebrafish
• Host: Mouse
• Isotype: IgG2b
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480).
  Mouse: 100% identity (72/72 amino acids identical)
  Rat: 100% identity (72/72 amino acids identical)
  Some identity with Kv1.1, Kv1.3 and Kv1.4
• Specificity: No cross-reactivity against Kv1.1, Kv1.3, Kv1.4, Kv1.5 or Kv1.6
• Formulation: State: Supernatant
• Conjugation: Unconjugated
• Gene Name: potassium voltage-gated channel subfamily A member 2
• Database Link:
  Entrez Gene 3737 Human
  UniProt ID P16389
• Synonyms: Potassium voltage-gated channel subfamily A member 2, Voltage-gated potassium channel subunit Kv1.2, HBK5, NGK1, HUKIV, KCNA2
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
  "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
  Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
  View Research License Agreement