Abcc8 Mouse Monoclonal Antibody [Clone ID: N289/16]

CAT#: 73-267

Abcc8 mouse monoclonal antibody, clone N289/16

Product Images

Immunoblot versus crude brain membrane preparations from rat (RBM), SUR1 wild-type (WT) and knockout (KO) mice and probed with N289/16 (left), N52A/42 (center) and K89/34 (right) TC supe. Mouse brains courtesy of William Coetzee and Margaret Rice, New York University Medical Center.

• 

  Immunofluorescence against SUR1 WT (left) and null mutant (right) mouse striatum and stained with N289/16 (green) and commercial antibody against Tyrosine Hydroxylase (blue). Images courtesy of Paul Witkovsky, Jyoti Patel and Margaret Rice, New York University Medical Center.

• 

  Adult rat hippocampus immunohistochemistry (with antigen retrieval via Na citrate pretreatment)

Specifications

Product Data

• Clone Name: N289/16
• Applications: IF, IHC, WB
• Recommended Dilution: Immunoblot (IB)
  Immunohistochemistry (IHC)
  Immunocytochemistry (ICC)
• Reactivities: Hamster, Human, Mouse
• Host: Mouse
• Isotype: IgG1
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS,ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429).
  Mouse: 100% identity (35/35 amino acids identical).
  Human: 94% identity (33/35 amino acids identical).
  Similar % identity with other isoforms.
  >70% identity with SUR2B.
• Specificity: Does not cross-react with SUR2B
• Formulation: State: Supernatant
• Conjugation: Unconjugated
• Gene Name: ATP binding cassette subfamily C member 8
• Database Link:
  UniProt ID Q09429
• Synonyms: HRINS, SUR, SUR1, Sulfonylurea receptor 1
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
  "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
  Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
  View Research License Agreement