Reep2 Mouse Monoclonal Antibody [Clone ID: N326D/2]

CAT#: 73-367

Reep2 mouse monoclonal antibody, clone N326D/2

Product Images

Immunoblot against extracts of COS cells transiently transfected with Flag-tagged REEP1, REEP2, REEP6 or untagged Kv2.1 plasmid probed with N326D/2 TC supe (left) or mouse anti-Flag (right).

• 

  Adult rat brain membrane immunoblot

• 

  Adult rat brain immunohistochemistry

• 

  Immunofluorescence staining of adult rat cerebellum with N29/29 (green, synapses), N326D/2 (red, Purkinje cells) and Hoechst stain (blue, nuclei).

Specifications

Product Data

• Clone Name: N326D/2
• Applications: IF, IHC, WB
• Recommended Dilution: Immunoblot (IB)
  Immunohistochemistry (IHC)
  Immunocytochemistry (ICC)
• Reactivities: Mouse, Rat
• Host: Mouse
• Isotype: IgG2a
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6).
  Rat: 97% identity (140/144 amino acids identical).
  Human: 86% identity (125/144 amino acids identical).
  <40% identity with REEP1 and REEP4 but >65% identity for first 46 amino acids (RDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL).
• Specificity: Does not cross-react with REEP1
• Formulation: State: Supernatant
• Conjugation: Unconjugated
• Gene Name: receptor accessory protein 2
• Database Link:
  Entrez Gene 225362 Mouse
  UniProt ID Q8VCD6
• Synonyms: SGC32445
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
  "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
  Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
  View Research License Agreement