Abcc8 Mouse Monoclonal Antibody [Clone ID: N289/16]

CAT#: 75-267

Abcc8 mouse monoclonal antibody, clone N289/16


USD 530.00

3 Weeks*

Size
    • 100 ul

Product Images

Specifications

Product Data
Clone Name N289/16
Applications IF, IHC, WB
Recommended Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Reactivities Hamster, Human, Mouse
Host Mouse
Isotype IgG1
Clonality Monoclonal
Immunogen Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (also known as Sulfonylurea receptor 1, SUR, HRINS,ATP binding cassette transporter subfamily C member 8 and Abcc8, accession number Q09429).
Mouse: 100% identity (35/35 amino acids identical).
Human: 94% identity (33/35 amino acids identical).
Similar % identity with other isoforms.
>70% identity with SUR2B.
Specificity Does not cross-react with SUR2B
Formulation State: Purified
Conjugation Unconjugated
Gene Name ATP binding cassette subfamily C member 8
Synonyms HRINS, SUR, SUR1, Sulfonylurea receptor 1
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.