MRP1 (ABCC1) Mouse Monoclonal Antibody [Clone ID: IU5C1]

CAT#: TA309560

Mouse Monoclonal MRP1 Antibody (IU5C1)

Product Images

Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU5C1) TA309560 - Staining of MRP1 using TA309560 in HEK293 cells with MRP1 expression.

• 

  Immunohistochemistry-Paraffin: MRP1 Antibody (IU5C1) TA309560 - Analysis of a FFPE tissue section of mouse testis using 1:200 dilution of MRP1 [IU5C1] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.

• 

  Western Blot: MRP1 Antibody (IU5C1) TA309560 - Detection of MRP1 in 10 ug of 293 transfected (lane 2) and empty vector (lane 1) lysate.

Specifications

Product Data

• Clone Name: IU5C1
• Applications: WB
• Recommended Dilution: Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin: 1:200, Immunohistochemistry: 1:200, Western Blot: 1:250 - 1:500
• Reactivities: Human, Mouse
• Host: Mouse
• Isotype: IgG1
• Clonality: Monoclonal
• Immunogen: A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]
• Formulation: 0.1% Sodium Azide
• Purification: Ascites
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Gene Name: ATP binding cassette subfamily C member 1
• Database Link:
  NP_004987
  Entrez Gene 17250 MouseEntrez Gene 4363 Human
  UniProt ID P33527
• Synonyms: ABC29; ABCC; GS-X; MRP; MRP1

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: ABC transporters