MRP1 (ABCC1) Mouse Monoclonal Antibody [Clone ID: IU5C1]

CAT#: TA309560

Mouse Monoclonal MRP1 Antibody (IU5C1)


USD 424.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "MRP1"

Specifications

Product Data
Clone Name IU5C1
Applications WB
Recommended Dilution Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin: 1:200, Immunohistochemistry: 1:200, Western Blot: 1:250 - 1:500
Reactivities Human, Mouse
Host Mouse
Isotype IgG1
Clonality Monoclonal
Immunogen A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527]
Formulation 0.1% Sodium Azide
Purification Ascites
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Gene Name ATP binding cassette subfamily C member 1
Synonyms ABC29; ABCC; GS-X; MRP; MRP1
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.