Kcna1 Rabbit Polyclonal Antibody

CAT#: TA328928

Rabbit polyclonal Anti-KV1.1

Product Images

Western blot analysis of rat brain membranes: 1. Anti-Kv1.1 antibody, (1:200). 2. Anti-Kv1.1 antibody, preincubated with the control peptide antigen.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB: 1:200-1:2000; IHC: 1:100-1:3000
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGN CTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse Kv1.1, (MW: 36 kDa.).Intracellular, C-terminus.
• Formulation: Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
• Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to Kv1.2 by affinity chromatography on immobilized KV1.2-GST-fusion protein, and then the antibody was affinity purified on immo
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Gene Name: potassium voltage-gated channel, shaker-related subfamily, member 1
• Database Link:
  NP_034725
  Entrez Gene 3736 HumanEntrez Gene 24520 RatEntrez Gene 16485 Mouse
  UniProt ID P16388
• Background: KV1.1 is a mammalian voltage dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.1 was the first mammalian KV channel to be cloned from mouse brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes. A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.1 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in retina and pancreas.2 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. Mutations in the coding of KV1.1 gene were discovered in Episodic Ataxia patients.
• Synonyms: AEMK; EA1; HBK1; HUK1; HUKI; Kv1.1; MBK1; MGC126782; MGC138385; MK1; RBK1