Germany
Japan
United Kingdom
China
ZNF394 Rabbit Polyclonal Antibody
Product Images
Other products for "ZNF394"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZNF394 antibody: synthetic peptide directed towards the N terminal of human ZNF394. Synthetic peptide located within the following region: GPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDPETSRLH |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 64 kDa |
| Gene Name | zinc finger protein 394 |
| Database Link | |
| Background | ZNF394 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
| Synonyms | ZKSCAN14; ZSCAN46 |
| Note | Immunogen sequence homology: Human: 100%; Horse: 79% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.