Cdk8 Rabbit Polyclonal Antibody

CAT#: TA329126

Rabbit Polyclonal anti-RGD1560888 Antibody

Product Images

Host: Rabbit; Target Name: RGD1560888; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RGD1560888 antibody is: synthetic peptide directed towards the N-terminal region of Rat RGD1560888. Synthetic peptide located within the following region: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: cyclin-dependent kinase 8
• Database Link:
  NP_001102531
  Entrez Gene 498140 Rat
• Background: The function of this protein remains unknown.
• Synonyms: K35; MGC126074; MGC126075
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 75%; Guinea pig: 75%