Hsp75 (TRAP1) Rabbit Polyclonal Antibody

CAT#: TA329130

Rabbit Polyclonal anti-TRAP1 Antibody

Product Images

WB Suggested Anti-TRAP1 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole CellTRAP1 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRAP1 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAP1. Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: TNF receptor associated protein 1
• Database Link:
  NP_057376
  Entrez Gene 10131 Human
  UniProt ID Q12931
• Background: Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS.
• Synonyms: HSP 75; HSP75; HSP90L; TRAP-1
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome