Hsp75 (TRAP1) Rabbit Polyclonal Antibody
Other products for "TRAP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TRAP1 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAP1. Synthetic peptide located within the following region: RRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 80 kDa |
Gene Name | TNF receptor associated protein 1 |
Database Link | |
Background | Suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS. |
Synonyms | HSP 75; HSP75; HSP90L; TRAP-1 |
Note | Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.