TYK2 Rabbit Polyclonal Antibody

CAT#: TA329144

Rabbit Polyclonal anti-TYK2 antibody

Product Images

WB Suggested Anti-TYK2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TYK2 antibody: synthetic peptide directed towards the C terminal of human TYK2. Synthetic peptide located within the following region: HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 134 kDa
• Gene Name: tyrosine kinase 2
• Database Link:
  NP_003322
  Entrez Gene 7297 Human
  UniProt ID P29597
• Background: This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E.
• Synonyms: IMD35; JTK1
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 91%; Bovine: 91%; Guinea pig: 91%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Jak-STAT signaling pathway