Bcl2l2 Rabbit Polyclonal Antibody

CAT#: TA329149

Rabbit Polyclonal anti-Bcl2l2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Bcl2l2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Bcl2l2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Bcl2l2. Synthetic peptide located within the following region: VQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 21 kDa
Gene Name BCL2-like 2
Background Bcl2l2 promotes cell survival. It blocks dexamethasone-induced apoptosis and mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.
Synonyms BCL-W; Bcl2-L-2; BCLW; KIAA0271
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.