ETS1 Rabbit Polyclonal Antibody

CAT#: TA329150

Rabbit Polyclonal anti-ETS1 Antibody

Product Images

Host: Rabbit; Target Name: ETS1; Sample Tissue: Thyroid tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: ETS proto-oncogene 1, transcription factor
• Database Link:
  NP_005229
  Entrez Gene 2113 Human
  UniProt ID P14921
• Background: The function of this protein remains unknown.
• Synonyms: ETS-1; EWSR2; p54
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma