Progesterone Receptor Rabbit Polyclonal Antibody

CAT#: TA329187

Rabbit Polyclonal anti-PR Antibody

Product Images

Host: Rabbit; Target Name: PR; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PR antibody is: synthetic peptide directed towards the N-terminal region of Human PR. Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Database Link:
  NP_000917
  Entrez Gene 5241 Human
• Background: The function of this protein remains unknown.
• Synonyms: NR3C3; PR
• Note: Immunogen sequence homology: Human: 100%; Rat: 91%; Rabbit: 91%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Oocyte meiosis, Progesterone-mediated oocyte maturation