Bcl11a Rabbit Polyclonal Antibody

CAT#: TA329189

Rabbit Polyclonal anti-Bcl11a Antibody

Product Images

Host: Rabbit; Target Name: Bcl11a; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Bcl11a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Bcl11a. Synthetic peptide located within the following region: GLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: B cell CLL/lymphoma 11A (zinc finger protein)
• Database Link:
  NP_001152761
  Entrez Gene 14025 Mouse
  UniProt ID Q9QYE3
• Background: The function of this protein remains unknown.
• Synonyms: BCL11A-L; BCL11A-S; BCL11A-XL; CTIP1; EVI-9; EVI9; FLJ10173; FLJ34997; HBFQTL5; KIAA1809; ZNF856
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92%