LYL1 Rabbit Polyclonal Antibody

CAT#: TA329192

Rabbit Polyclonal anti-LYL1 Antibody

Product Images

Host: Rabbit; Target Name: LYL1; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LYL1 antibody is: synthetic peptide directed towards the C-terminal region of Human LYL1. Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: lymphoblastic leukemia associated hematopoiesis regulator 1
• Database Link:
  NP_005574
  Entrez Gene 4066 Human
  UniProt ID P12980
• Background: This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia.
• Synonyms: bHLHa18
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors