E74 like factor 1 (ELF1) Rabbit Polyclonal Antibody

CAT#: TA329207

Rabbit Polyclonal anti-ELF1 antibody

Product Images

WB Suggested Anti-ELF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate

• 

  Spleen

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELF1 antibody: synthetic peptide directed towards the N terminal of human ELF1. Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: E74 like ETS transcription factor 1
• Database Link:
  NP_001138825
  Entrez Gene 1997 Human
  UniProt ID P32519
• Background: ELF1 belongs to the ETS family. It contains 1 ETS DNA-binding domain. ELF1 is a transcription factor that activates the LYN and BLK promoters. It appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. ELF1 binds specifically to two purine-rich motifs in the HIV-2 enhancer.
• Synonyms: E74-like factor 1 (ets domain transcription factor); OTTHUMP00000018310
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Transcription Factors