Nfe2 Rabbit Polyclonal Antibody

CAT#: TA329220

Rabbit Polyclonal anti-Nfe2 Antibody

Product Images

Host: Rabbit; Target Name: Nfe2; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nfe2 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2. Synthetic peptide located within the following region: ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: nuclear factor, erythroid derived 2
• Database Link:
  NP_032711
  Entrez Gene 18022 Mouse
  UniProt ID Q07279
• Background: Nfe2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation.It binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. It requires MAFK or other small MAF proteins for binding to the NF-E2 motif. It may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.
• Synonyms: NF-E2; p45
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%; Horse: 79%