ELK4 Rabbit Polyclonal Antibody
Other products for "ELK4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ELK4 antibody: synthetic peptide directed towards the C terminal of human ELK4. Synthetic peptide located within the following region: ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 45 kDa |
Gene Name | ELK4, ETS transcription factor |
Database Link | |
Background | The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8. |
Synonyms | SAP1 |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | MAPK signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.