ELK4 Rabbit Polyclonal Antibody

CAT#: TA329226

Rabbit Polyclonal anti-ELK4 antibody

Product Images

WB Suggested Anti-ELK4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateELK4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELK4 antibody: synthetic peptide directed towards the C terminal of human ELK4. Synthetic peptide located within the following region: ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: ELK4, ETS transcription factor
• Database Link:
  NP_068567
  Entrez Gene 2005 Human
  UniProt ID P28324
• Background: The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8.
• Synonyms: SAP1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: MAPK signaling pathway