Atf3 Rabbit Polyclonal Antibody

CAT#: TA329230

Rabbit Polyclonal anti-Atf3 Antibody

Product Images

WB Suggested Anti-Atf3 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Atf3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Atf3. Synthetic peptide located within the following region: ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: activating transcription factor 3
• Database Link:
  NP_031524
  Entrez Gene 11910 Mouse
  UniProt ID Q60765
• Background: This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter.
• Synonyms: ATF3deltaZip2; ATF3deltaZip2c; ATF3deltaZip3; OTTHUMP00000034890
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%