ATF1 Rabbit Polyclonal Antibody

CAT#: TA329248

Rabbit Polyclonal anti-ATF1 Antibody

Product Images

Host: Rabbit; Target Name: ATF1; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ATF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF1. Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: activating transcription factor 1
• Database Link:
  NP_005162
  Entrez Gene 466 Human
  UniProt ID P18846
• Background: ATF1 binds the cAMP response element (CRE) (consensus: 5'-GTGACGT [AC] [AG]-3'), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes.
• Synonyms: ATF-1; EWS-ATF1; FUS; TREB36
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors