ATF1 Rabbit Polyclonal Antibody
Other products for "ATF1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | IHC, WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the middle region of human ATF1. Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 29 kDa |
Gene Name | activating transcription factor 1 |
Database Link | |
Background | ATF1 binds the cAMP response element (CRE) (consensus: 5'-GTGACGT [AC] [AG]-3'), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes. |
Synonyms | ATF-1; EWS-ATF1; FUS; TREB36 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Zebrafish: 82% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.