ATF1 Rabbit Polyclonal Antibody

CAT#: TA329249

Rabbit Polyclonal anti-ATF1 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ATF1"

Specifications

Product Data
Applications WB
Recommended Dilution IHC, WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the middle region of human ATF1. Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name activating transcription factor 1
Background ATF1 binds the cAMP response element (CRE) (consensus: 5'-GTGACGT [AC] [AG]-3'), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes.
Synonyms ATF-1; EWS-ATF1; FUS; TREB36
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 93%; Zebrafish: 82%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.