LYL1 Rabbit Polyclonal Antibody
Other products for "LYL1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LYL1 antibody: synthetic peptide directed towards the C terminal of human LYL1. Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 38 kDa |
Gene Name | lymphoblastic leukemia associated hematopoiesis regulator 1 |
Database Link | |
Background | LYL1 contains 1 basic helix-loop-helix (bHLH) domain. A chromosomal aberration, translocation t (7;19)(q35;p13) with TCRB, involving LYL1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). |
Synonyms | bHLHa18 |
Note | Immunogen sequence homology: Human: 100%; Pig: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.