LYL1 Rabbit Polyclonal Antibody

CAT#: TA329261

Rabbit Polyclonal anti-LYL1 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "LYL1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LYL1 antibody: synthetic peptide directed towards the C terminal of human LYL1. Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name lymphoblastic leukemia associated hematopoiesis regulator 1
Background LYL1 contains 1 basic helix-loop-helix (bHLH) domain. A chromosomal aberration, translocation t (7;19)(q35;p13) with TCRB, involving LYL1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL).
Synonyms bHLHa18
Note Immunogen sequence homology: Human: 100%; Pig: 92%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.