Myf5 Rabbit Polyclonal Antibody

CAT#: TA329268

Rabbit Polyclonal anti-Myf5 Antibody

Product Images

Host: Rabbit; Target Name: Myf5; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Myf5 antibody is: synthetic peptide directed towards the middle region of Rat Myf5. Synthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: myogenic factor 5
• Database Link:
  NP_001100253
  Entrez Gene 299766 Rat
• Background: The function of this protein remains unknown.
• Synonyms: bHLHc2; Myf-5
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%