TCF7 Rabbit Polyclonal Antibody

CAT#: TA329279

Rabbit Polyclonal anti-TCF7 Antibody

Product Images

Host: Rabbit; Target Name: TCF7; Sample Tissue: Thyroid Tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the C-terminal region of Human TCF7. Synthetic peptide located within the following region: AKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDNSLHYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: transcription factor 7 (T-cell specific, HMG-box)
• Database Link:
  NP_963965
  Entrez Gene 6932 Human
  UniProt ID P36402
• Background: The protein encoded by this gene is a transcriptional activator that plays an important role in lymphocyte differentiation. This gene is expressed predominantly in T-cells. The encoded protein can bind an enhancer element and activate the CD3E gene, and it also may repress the CTNNB1 and TCF7L2 genes through a feedback mechanism. Several transcript variants encoding different isoforms have been found for this gene.
• Synonyms: TCF-1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Melanogenesis, Pathways in cancer, Prostate cancer, Thyroid cancer, Wnt signaling pathway