HDAC6 Rabbit Polyclonal Antibody

CAT#: TA329290

Rabbit Polyclonal anti-HDAC6 antibody

Product Images

WB Suggested Anti-HDAC6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that HDAC6 is expressed in HEK293T

• 

  Chromatin Immunoprecipitation (ChIP) Using HDAC6 antibody - N-terminal region and HCT116 Cells

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, ChIP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HDAC6 antibody: synthetic peptide directed towards the N terminal of human HDAC6. Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 131 kDa
• Gene Name: histone deacetylase 6
• Database Link:
  NP_006035
  Entrez Gene 10013 Human
  UniProt ID Q9UBN7
• Background: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.
• Synonyms: CPBHM; HD6; JM21; PPP1R90
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors