JAB1 (COPS5) Rabbit Polyclonal Antibody

CAT#: TA329313

Rabbit Polyclonal anti-COPS5 antibody

Product Images

WB Suggested Anti-COPS5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Human Muscle

• 

  Sample Type: 1. Human blood cells, pure; 2. Human blood cells, partially purified; 3. and 4. Human total cell extract, extraction only; Primary Dilution: 1:500; Secondary Anitbody: HRP conjugated anti-rabbit; Image Submitted By: Dr. Elah Pick; University of Haifa at Oranim

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: COP9 signalosome subunit 5
• Database Link:
  NP_006828
  Entrez Gene 26754 MouseEntrez Gene 10987 Human
  UniProt ID Q92905
• Background: COPS5 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CSN5; JAB1; MOV-34; SGN5
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Protease, Transcription Factors