KAT7 Rabbit Polyclonal Antibody

CAT#: TA329316

Rabbit Polyclonal anti-MYST2 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "KAT7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 71 kDa
Gene Name lysine acetyltransferase 7
Background MYST2 belongs to the MYST family, which is characterized by a highly conserved C2HC zinc finger and a putative histone acetyltransferase domain. MYST2 specifically represses AR-mediated transcription. MYST2 is a new AR-interacting protein capable of modulating AR activity. It could play a significant role in regulating AR-dependent genes in normal and prostate cancer cells. The biochemical and genetic interactions of MYST family protein MYST2 with two components of the replication apparatus, MCM2 and ORC1, suggest that MYST2-associated HAT activity may play a direct role in the process of DNA replication. MYST2 is a positive regulatory factor for prereplicative complex assembly.
Synonyms HBO1; HBOA; MYST2; ZC2HC7
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.