EAP30 (SNF8) Rabbit Polyclonal Antibody

CAT#: TA329321

Rabbit Polyclonal anti-EAP30 antibody

Product Images

WB Suggested Anti-EAP30 Antibody Titration: 5.0ug/ml; Positive Control: HepG2 cell lysateSNF8 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Spleen

• 

  Human Heart

• 

  Rabbit Anti-EAP30 Antibody; Paraffin Embedded Tissue: Human Stomach; Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30. Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: SNF8, ESCRT-II complex subunit
• Database Link:
  NP_009172
  Entrez Gene 11267 Human
  UniProt ID Q96H20
• Background: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]). [supplied by OMIM]
• Synonyms: Dot3; EAP30; VPS22
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Endocytosis