CMTM2 Rabbit Polyclonal Antibody

CAT#: TA329336

Rabbit Polyclonal anti-CMTM2 antibody

Product Images

WB Suggested Anti-CMTM2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CMTM2 antibody: synthetic peptide directed towards the N terminal of human CMTM2. Synthetic peptide located within the following region: DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: CKLF like MARVEL transmembrane domain containing 2
• Database Link:
  NP_653274
  Entrez Gene 146225 Human
  UniProt ID Q8TAZ6
• Background: CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.
• Synonyms: CKLFSF2
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Dog: 87%; Bovine: 87%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane