GATA5 Rabbit Polyclonal Antibody

CAT#: TA329360

Rabbit Polyclonal anti-GATA5 antibody

Product Images

WB Suggested Anti-GATA5 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate

• 

  Lanes: Lane 1: 25 ug empty vector transfected H460 cell lysate; Lane 2: 25 ug hGATA5 transfected H460 cell lysate; Primary Antibody Dilution: 1:1200; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:3500; Gene Name: GATA5; Submitted by: Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the middle region of human GATA5. Synthetic peptide located within the following region: SAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: GATA binding protein 5
• Database Link:
  NP_536721
  Entrez Gene 140628 Human
  UniProt ID Q9BWX5
• Background: The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity.
• Synonyms: bB379O24.1; GATAS
• Note: Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Horse: 85%; Sheep: 85%; Bovine: 85%; Guinea pig: 85%; Rat: 77%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors