ZNF449 Rabbit Polyclonal Antibody

CAT#: TA329370

Rabbit Polyclonal anti-ZNF449 antibody

Product Images

WB Suggested Anti-ZNF449 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF449 antibody: synthetic peptide directed towards the middle region of human ZNF449. Synthetic peptide located within the following region: LENREEPWVKELQDSKEMKQLLDSKIGFEIGIENEEDTSKQKKMETMYPF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: zinc finger protein 449
• Database Link:
  NP_689908
  Entrez Gene 203523 Human
  UniProt ID Q6P9G9
• Background: ZNF449 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 SCAN box domain. ZNF449 may be involved in transcriptional regulation.
• Synonyms: ZSCAN19
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Rat: 86%; Guinea pig: 77%

Reference Data

• Protein Families: Transcription Factors