DHRSX Rabbit Polyclonal Antibody

CAT#: TA329372

Rabbit Polyclonal anti-DHRSX antibody

Product Images

WB Suggested Anti-DHRSX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHRSX antibody: synthetic peptide directed towards the C terminal of human DHRSX. Synthetic peptide located within the following region: DEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: dehydrogenase/reductase X-linked
• Database Link:
  NP_660160
  Entrez Gene 207063 Human
  UniProt ID Q8N5I4
• Background: DHRSX belongs to the short-chain dehydrogenases/reductases (SDR) family. The exact function of DHRSX remains unknown.
• Synonyms: CXorf11; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR7C6; SDR46C1
• Note: Immunogen sequence homology: Dog: 100%; Human: 93%; Pig: 92%; Guinea pig: 92%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome