TOLLIP Rabbit Polyclonal Antibody
Other products for "TOLLIP"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TOLLIP antibody: synthetic peptide directed towards the C terminal of human TOLLIP. Synthetic peptide located within the following region: MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 30 kDa |
Gene Name | toll interacting protein |
Database Link | |
Background | TOLLIP is component of the signaling pathway of IL-1 and Toll-like receptors. It Inhibits cell activation by microbial products. It also recruits IRAK1 to the IL-1 receptor complex and inhibits IRAK1 phosphorylation and kinase activity. |
Synonyms | IL-1RAcPIP |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 85%; Rabbit: 83%; Yeast: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Toll-like receptor signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.