PDK2 Rabbit Polyclonal Antibody

CAT#: TA329403

Rabbit Polyclonal anti-PDK2 antibody

Product Images

WB Suggested Anti-PDK2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: 293T cell lysatePDK2 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Heart cell lysates

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDK2 antibody: synthetic peptide directed towards the middle region of human PDK2. Synthetic peptide located within the following region: ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: pyruvate dehydrogenase kinase 2
• Database Link:
  NP_002602
  Entrez Gene 5164 Human
  UniProt ID Q15119
• Background: PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
• Synonyms: PDHK2; PDKII
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 77%; Zebrafish: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase