PTF1A Rabbit Polyclonal Antibody

CAT#: TA329416

Rabbit Polyclonal anti-PTF1A antibody

Product Images

WB Suggested Anti-PTF1A Antibody Titration: 2.5ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: pancreas specific transcription factor, 1a
• Database Link:
  NP_835455
  Entrez Gene 256297 Human
  UniProt ID Q7RTS3
• Background: PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.
• Synonyms: bHLHa29; PACA; PAGEN2; PTF1-p48
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Mouse: 92%; Zebrafish: 86%; Dog: 85%; Horse: 77%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS