Hey L (HEYL) Rabbit Polyclonal Antibody

CAT#: TA329430

Rabbit Polyclonal anti-HEYL antibody

Product Images

WB Suggested Anti-HEYL Antibody Titration: 1.0 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HEYL antibody: synthetic peptide directed towards the N terminal of human HEYL. Synthetic peptide located within the following region: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: hes related family bHLH transcription factor with YRPW motif-like
• Database Link:
  NP_055386
  Entrez Gene 26508 Human
  UniProt ID Q9NQ87
• Background: HEYL belongs to hairy-related bHLH transcription factor family. HEY genes are candidates for several human or mouse disease loci.
• Synonyms: bHLHb33; HESR3; HEY3; HRT3
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 92%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors