KLF15 Rabbit Polyclonal Antibody

CAT#: TA329447

Rabbit Polyclonal anti-KLF15 antibody

Product Images

WB Suggested Anti-KLF15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF15 antibody: synthetic peptide directed towards the middle region of human KLF15. Synthetic peptide located within the following region: GPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: Kruppel-like factor 15
• Database Link:
  NP_054798
  Entrez Gene 28999 Human
  UniProt ID Q9UIH9
• Background: KLF15 is a Cys2-His2 zinc finger gene. It is found abundantly expressed in the liver, kidneys, heart, and skeletal muscle.
• Synonyms: KKLF
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 92%; Dog: 91%; Horse: 86%

Reference Data

• Protein Families: Transcription Factors