LRRC2 Rabbit Polyclonal Antibody

CAT#: TA329471

Rabbit Polyclonal anti-LRRC2 antibody

Product Images

WB Suggested Anti-LRRC2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRRC2 antibody: synthetic peptide directed towards the N terminal of human LRRC2. Synthetic peptide located within the following region: GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: leucine rich repeat containing 2
• Database Link:
  NP_079026
  Entrez Gene 79442 Human
  UniProt ID Q9BYS8
• Background: The function remains unknown.
• Synonyms: leucine-rich repeat-containing 2; leucine rich repeat containing 2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome