Alkaline Phosphatase (ALPPL2) Rabbit Polyclonal Antibody

CAT#: TA329490

Rabbit Polyclonal anti-ALPPL2 antibody

Product Images

WB Suggested Anti-ALPPL2 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2. Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: alkaline phosphatase, placental like 2
• Database Link:
  NP_112603
  Entrez Gene 251 Human
  UniProt ID P10696
• Background: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The exact physiological function of the alkaline phosphatases is not known. ALPPL2 is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The exact physiological function of the alkaline phosphatases is not known. The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.
• Synonyms: ALPG; ALPPL; GCAP
• Note: Immunogen sequence homology: Human: 100%; Mouse: 82%; Pig: 79%; Rat: 79%; Horse: 79%; Bovine: 79%; Dog: 77%; Rabbit: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Folate biosynthesis, Metabolic pathways