Alkaline Phosphatase (ALPPL2) Rabbit Polyclonal Antibody

CAT#: TA329491

Rabbit Polyclonal anti-ALPPL2 antibody

Product Images

WB Suggested Anti-ALPPL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the middle region of human ALPPL2. Synthetic peptide located within the following region: SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: alkaline phosphatase, placental like 2
• Database Link:
  NP_112603
  Entrez Gene 251 Human
  UniProt ID P10696
• Background: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq, Jul 2008]
• Synonyms: ALPG; ALPPL; GCAP
• Note: Immunogen sequence homology: Human: 100%; Bovine: 93%; Dog: 86%; Zebrafish: 86%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Folate biosynthesis, Metabolic pathways