SIGLEC6 Rabbit Polyclonal Antibody

CAT#: TA329522

Rabbit Polyclonal anti-SIGLEC6 antibody

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the middle region of human SIGLEC6. Synthetic peptide located within the following region: FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: sialic acid binding Ig like lectin 6
• Database Link:
  NP_942143
  Entrez Gene 946 Human
  UniProt ID O43699
• Background: SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
• Synonyms: CD33L; CD33L1; CD33L2; CD327; CDW327; OBBP1
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Dog: 91%; Pig: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 82%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane