Antibodies

View as table Download

SIGLEC6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC6

Rabbit Polyclonal Anti-SIGLEC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the N terminal of human SIGLEC6. Synthetic peptide located within the following region: VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL

Rabbit Polyclonal Anti-SIGLEC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the N terminal of human SIGLEC6. Synthetic peptide located within the following region: MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP

Rabbit Polyclonal Anti-SIGLEC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the C terminal of human SIGLEC6. Synthetic peptide located within the following region: IVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

Goat Anti-SIGLEC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KWMKYGYTSSK, from the internal region of the protein sequence according to NP_001236.4; NP_942142.3; NP_942143.3.

Rabbit Polyclonal anti-SIGLEC6 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the middle region of human SIGLEC6. Synthetic peptide located within the following region: FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT

Rabbit Polyclonal Anti-SIGLEC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC6

SIGLEC6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SIGLEC6